BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0323 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0471 - 17563245-17563488,17563564-17563655,17563941-175640... 32 0.42 05_07_0344 + 29411767-29411961,29412692-29412741,29413295-294134... 30 1.7 09_02_0435 - 9384225-9384412,9385084-9385133,9385209-9385274,938... 30 2.2 12_02_1222 + 27145264-27148287 29 2.9 04_01_0305 - 4141692-4142912 28 9.0 02_02_0592 - 11934238-11934249,11934755-11934835,11935166-119353... 28 9.0 >08_02_0471 - 17563245-17563488,17563564-17563655,17563941-17564023, 17564418-17564499,17565234-17565461,17565553-17565654, 17565818-17565953,17566080-17566129,17566465-17566572, 17568702-17568911 Length = 444 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 183 RSDARLEFTGYKKLNETIREIVLYYDNTIH 272 R DA + F G K + E++++ +LYYDN ++ Sbjct: 123 RFDAVVHFAGLKAVGESVQKPLLYYDNNVN 152 >05_07_0344 + 29411767-29411961,29412692-29412741,29413295-29413430, 29413931-29414032,29414153-29414380,29414460-29414544, 29414648-29414730,29414854-29414945,29415048-29415141 Length = 354 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 183 RSDARLEFTGYKKLNETIREIVLYYDNTI 269 R +A + F G K + E++++ +LYYDN + Sbjct: 82 RFEAVIHFAGLKAVGESVQKPLLYYDNNL 110 >09_02_0435 - 9384225-9384412,9385084-9385133,9385209-9385274, 9385360-9385451,9385893-9385975,9386181-9386259, 9386888-9387115,9387196-9387297,9387719-9387854, 9387984-9388033,9389391-9389618 Length = 433 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 183 RSDARLEFTGYKKLNETIREIVLYYDNTI 269 R DA + F G K + E++++ +LYYD+ + Sbjct: 93 RFDAVVHFAGLKAVGESVQKPLLYYDHNV 121 >12_02_1222 + 27145264-27148287 Length = 1007 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 12 RLEGGAASRCNYTTLQLISQGGWRIYAVNVYGL 110 R + AAS CN+T + + GG + AV V GL Sbjct: 49 RWDAAAASPCNFTGVDCANSGGGGVTAVAVEGL 81 >04_01_0305 - 4141692-4142912 Length = 406 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = +3 Query: 129 RWAVSSFTHLSNKKSVCVRSDARLEFTGYKKLNETIREIVLYYDNTIHYRL 281 RW V+ T LSN+KS RL + NE R Y +T+ YR+ Sbjct: 67 RWLVNENTELSNEKSYLESRVRRLVNENTELSNEKRR--AAYVSSTLEYRV 115 >02_02_0592 - 11934238-11934249,11934755-11934835,11935166-11935324, 11936362-11936442,11936523-11936591,11937147-11937260, 11937805-11937858,11938788-11938915,11940527-11940782 Length = 317 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +2 Query: 218 KIKRNNTRNSSIL---RQHDTLQIINKLTRHKTND*QIYENTIMRETRDQYEALWR 376 K K NN +S L +HD ++NK K + + Y + ++ D+ + LWR Sbjct: 97 KSKANNLEENSNLIGTMEHDIEILMNKYESTKKSQSKSYPESNVKALEDEVQLLWR 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,708,342 Number of Sequences: 37544 Number of extensions: 396757 Number of successful extensions: 917 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -