Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0313
         (582 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    22   3.3  
AF260822-1|AAG02020.1|  138|Tribolium castaneum alpha-esterase l...    22   4.4  

>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
           protein.
          Length = 377

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 3/41 (7%)
 Frame = -3

Query: 565 PFKSNVESVAY---FIFHSGEDCVYLANLYLTPVIESPFWI 452
           P+  N+ S+ Y     FH     V+L ++ +  + E  FWI
Sbjct: 284 PYTVNLGSLGYNEICEFHRNGTVVFLDDMKVPYMYEDTFWI 324


>AF260822-1|AAG02020.1|  138|Tribolium castaneum alpha-esterase like
           protein E3 protein.
          Length = 138

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 535 YFIFHSGEDCVY 500
           YFIF SG D +Y
Sbjct: 83  YFIFGSGNDDIY 94


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,955
Number of Sequences: 336
Number of extensions: 2352
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14517299
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)