BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0313 (582 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 25 2.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 5.5 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 24.6 bits (51), Expect = 2.4 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +2 Query: 296 LFAIVTCRHFNFNKTEHRHARPICQPSLLLPA*NHTVSLNVTMGGLGVDRGLNP 457 L A+V C + H+ P P L P +HTVS + +GG +D P Sbjct: 12 LLAVVACAQAH---ASHQRRVPYPLPRFL-PRPHHTVSNHRIVGGFEIDVAETP 61 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 394 KSYSITQRNYGRARSRPRAQSKRGFRLQG*DINSRDKRSPL 516 +S S +Q + G RSR R++S+ G R + + + SP+ Sbjct: 1149 RSRSGSQASRGSRRSRSRSRSRSGSRSRSRSGSGSRQASPI 1189 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,699 Number of Sequences: 2352 Number of extensions: 10259 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -