BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0313 (582 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64844-14|AAO25986.1| 375|Caenorhabditis elegans Hypothetical p... 27 9.7 U64844-13|AAD56301.1| 453|Caenorhabditis elegans Hypothetical p... 27 9.7 >U64844-14|AAO25986.1| 375|Caenorhabditis elegans Hypothetical protein T22F3.11b protein. Length = 375 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -1 Query: 237 GFNVFMGVVLVYCESVSRALQIIFCFLFMEFFXPLTCLSSLIAIMLS 97 GFN ++ ++L +C+ ++ + L + PLT ++ IA+M S Sbjct: 114 GFNYWILILLRFCQGLAYSADFAAIGLITVRWAPLTETATFIAVMTS 160 >U64844-13|AAD56301.1| 453|Caenorhabditis elegans Hypothetical protein T22F3.11a protein. Length = 453 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -1 Query: 237 GFNVFMGVVLVYCESVSRALQIIFCFLFMEFFXPLTCLSSLIAIMLS 97 GFN ++ ++L +C+ ++ + L + PLT ++ IA+M S Sbjct: 114 GFNYWILILLRFCQGLAYSADFAAIGLITVRWAPLTETATFIAVMTS 160 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,965,955 Number of Sequences: 27780 Number of extensions: 235421 Number of successful extensions: 563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1215936170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -