BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0312 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.0 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 6.9 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 518 LATKPNPLSDTPALTTRGPRHH*P 589 L+ P LS PA+ T GP+ P Sbjct: 236 LSPHPPHLSSHPAIVTPGPKQELP 259 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 518 LATKPNPLSDTPALTTRGPRHH*P 589 L+ P LS PA+ T GP+ P Sbjct: 128 LSPHPPHLSSHPAIVTPGPKQELP 151 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/43 (20%), Positives = 17/43 (39%) Frame = +2 Query: 68 TVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAE 196 T+S CK + H+ V F +++ ++ G E Sbjct: 31 TISQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSLTE 73 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/37 (27%), Positives = 13/37 (35%), Gaps = 3/37 (8%) Frame = -1 Query: 344 CPGTTTSGRASVS---C*PPTCPGTGACIQSQTGHIC 243 CP T ++ C P C G C+ G C Sbjct: 248 CPSGTLGYICEINVDDCRPGACHNNGTCLDKVGGFEC 284 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,698 Number of Sequences: 336 Number of extensions: 2834 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -