BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0312 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 28 0.23 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.71 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 0.71 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 0.71 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 27 0.71 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.94 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 26 1.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 2.2 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 25 2.9 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 25 2.9 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 3.8 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 28.3 bits (60), Expect = 0.23 Identities = 19/65 (29%), Positives = 24/65 (36%) Frame = +1 Query: 388 RSEKVPCRSSEVHPSDRPLGSVSGGRRREAPRHRSPINSIYTRARDETEPALRHSCPDDT 567 R E SE P + P+G G R E P + Y + + PAL P Sbjct: 1087 REESFSSYRSETEPDNSPMG---GSPRPETPAFPVTPRTPYGLSNGTSSPALPPKSPTSQ 1143 Query: 568 RATTP 582 R T P Sbjct: 1144 RITLP 1148 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.71 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 71 VSDACKTTYEEIKKDKKHRYVVFYIRD 151 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.6 bits (56), Expect = 0.71 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 71 VSDACKTTYEEIKKDKKHRYVVFYIRD 151 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 0.71 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 71 VSDACKTTYEEIKKDKKHRYVVFYIRD 151 + AC +E+I + KH + + Y+RD Sbjct: 47 ILSACSPYFEQIFVENKHPHPIIYLRD 73 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.6 bits (56), Expect = 0.71 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 71 VSDACKTTYEEIKKDKKHRYVVFYIRD 151 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHLHPIIYLRD 121 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 0.94 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 341 DTAKVKKKMLYSSSFDALK 397 DTAKV +K+ YSS+F L+ Sbjct: 257 DTAKVFQKIFYSSAFSKLR 275 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 25.8 bits (54), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 326 SGRASVSC*PPTCPGTGAC 270 +GR +V C PP PG AC Sbjct: 31 NGRQNVGCNPPGIPGGPAC 49 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 481 RHRSPINSIYTRARDETEPALRHS 552 RHRS + + TR + +TE A+RH+ Sbjct: 1794 RHRSLVTATKTRKKQQTE-AIRHA 1816 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 451 VSGGRRREAPRHRSPINSIYTRARDETEPALRH 549 + GGRR P H + I+ I R R + E ++H Sbjct: 267 MGGGRREFLPTHETDIDGIRGR-RTDGEDLIKH 298 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 430 LDVLLNSDKGLFQSVERARVQH 365 +D+L +D G F VE R+ H Sbjct: 361 MDILERNDNGYFLFVEGGRIDH 382 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 242 CRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDAL 394 CR G +C G E ++ M CP A++++K+L ++ DA+ Sbjct: 955 CRMGFTPSPDCIRCTGVPETAEHA----MFECPRFAEIRQKLLGEANTDAI 1001 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 413 VQKYIQATDLSEASQEAVEEKLR 481 ++KY++ DLSE +E ++ +L+ Sbjct: 896 IEKYLKPLDLSEKQKEEMKSQLK 918 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,148 Number of Sequences: 2352 Number of extensions: 12860 Number of successful extensions: 30 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -