BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0309 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 27 3.3 SPAC25H1.03 |mug66|mug66|meiotically upregulated gene Mug66|Schi... 25 7.7 SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pom... 25 7.7 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 26.6 bits (56), Expect = 3.3 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = -1 Query: 636 RGGHLYDDHDNHSAHNSGIGNITSRSHRDASGRSRSVDFDQHGSTAGGTSKRRRENR 466 R H YDD+ ++S R +S SR+ D+D S R+ +R Sbjct: 166 RSRHRYDDYSRSPPYSSRHSRSRRRYEERSSRSSRAHDYDYEDLRDDDRSHERKRSR 222 >SPAC25H1.03 |mug66|mug66|meiotically upregulated gene Mug66|Schizosaccharomyces pombe|chr 1|||Manual Length = 184 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 545 QVVQGPSISTSTALPPVALRSDGEKIVIVYPSN 447 Q+VQ ++ + + LPPVA+ S IV P++ Sbjct: 132 QIVQAVNLRSLSYLPPVAMDSGNYPYEIVTPTS 164 >SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 549 HLCGSGS*YFRYHCCGRSDCRGRR 620 HLC + Y +HC + C GRR Sbjct: 199 HLCDNCVEYLDHHCIWLNTCIGRR 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,638,663 Number of Sequences: 5004 Number of extensions: 51564 Number of successful extensions: 143 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -