BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0308 (626 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF114152-1|AAD12541.1| 2098|Drosophila melanogaster rough deal p... 30 2.2 AE014297-4759|AAF57162.2| 2089|Drosophila melanogaster CG1569-PA... 30 2.2 >AF114152-1|AAD12541.1| 2098|Drosophila melanogaster rough deal protein protein. Length = 2098 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 464 IVYPSNVRDERKIRSHSYPEEMQFEALYHHTAAPKDLRVDL 342 ++Y + DE+ +R P E+ +ALYHH K +VD+ Sbjct: 1706 LLYVYGLTDEKLLRQVENPTEL-IQALYHHELILKSSKVDI 1745 >AE014297-4759|AAF57162.2| 2089|Drosophila melanogaster CG1569-PA protein. Length = 2089 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 464 IVYPSNVRDERKIRSHSYPEEMQFEALYHHTAAPKDLRVDL 342 ++Y + DE+ +R P E+ +ALYHH K +VD+ Sbjct: 1707 LLYVYGLTDEKLLRQVENPTEL-IQALYHHELILKSSKVDI 1746 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,830,729 Number of Sequences: 53049 Number of extensions: 543749 Number of successful extensions: 1604 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1604 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2600432100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -