BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0306 (614 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 48 2e-07 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 27 0.48 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 27 0.48 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 27 0.64 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 27 0.64 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 25 1.5 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 2.6 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 2.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 2.6 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 24 4.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 5.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 5.9 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 7.8 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 7.8 AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 23 7.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.8 AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein ... 23 7.8 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 7.8 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 48.4 bits (110), Expect = 2e-07 Identities = 49/148 (33%), Positives = 65/148 (43%), Gaps = 7/148 (4%) Frame = +2 Query: 182 SDNEAASGLGTRYRKPSVPRS-TLTPGTSRPGSRAGSRAGSKPPSRHGSNLSLDSTDDAT 358 SD E + G R R S S + + S GSRAGSRAGS SR S S + Sbjct: 1053 SDEEDSDGSQRRSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRSRSRSRSRSRSRSGSA 1112 Query: 359 TPSRIPMRKVTNTKTSIARAAANASKLGVSTPNGSRPRTPTGYLTP-----ASGRQRTPS 523 SR R + S +R+ + + G S +GSR R+ +G + R R+ S Sbjct: 1113 KGSRSRSRSGSGGSRSRSRSRSRSQSAG-SRKSGSRSRSRSGSQASRGSRRSRSRSRSRS 1171 Query: 524 GSTTPVRSGQ-QTAVSRLLRKPSDASES 604 GS + RSG S + RK SES Sbjct: 1172 GSRSRSRSGSGSRQASPISRKSVSGSES 1199 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 27.1 bits (57), Expect = 0.48 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 5/100 (5%) Frame = +2 Query: 257 GTSRP--GSRAGSRAG---SKPPSRHGSNLSLDSTDDATTPSRIPMRKVTNTKTSIARAA 421 GT+ P GS A S AG ++P + G + D SR R + +K+S +R+ Sbjct: 369 GTAAPSSGSNANSTAGLNNNEPDTAGGGTVG----DGKKRSSR--SRSKSLSKSSRSRSR 422 Query: 422 ANASKLGVSTPNGSRPRTPTGYLTPASGRQRTPSGSTTPV 541 + + + S GSR R+ T S + + S S TP+ Sbjct: 423 SLSRSVSRSRSRGSRSRSRTSQSRSRSKTRTSRSRSRTPL 462 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 27.1 bits (57), Expect = 0.48 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = -1 Query: 596 TRPTACAVDETPRSAVPTAPASCCPMGSFVFH*PASGNRSASEDGSRSA 450 T T V S+VP P++C P + ASG S GS +A Sbjct: 122 TGATGSNVPAQQNSSVPVRPSACTPDSRVGGYIDASGGSPVSRAGSAAA 170 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 26.6 bits (56), Expect = 0.64 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = -1 Query: 596 TRPTACAVDETPRSAVPTAPASCCPMGSFVFH*PASGNRSASEDGSRSA 450 T T V S+VP P++C P + ASG S GS +A Sbjct: 122 TGGTGSNVPAQQNSSVPVRPSACTPDSRVGGYIDASGGSPVSRAGSAAA 170 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.6 bits (56), Expect = 0.64 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 36 ALTQILLHQPDPSRR*GKEQLD-RCL-CPLERERPVALP 146 ALT L QP+P RR +E LD C P +++R V LP Sbjct: 449 ALTVALRQQPEPFRRVFQECLDMSCFPQPWKKQRLVLLP 487 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 25.4 bits (53), Expect = 1.5 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 493 RQVTGRRPRTGAVRRA-NPKLACIGGSTRDRSLR 395 R T +R A RR+ NP C GG R++S R Sbjct: 77 RTCTNQRKNDSACRRSCNPGCFCRGGYVRNKSNR 110 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 2.6 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 200 SGLGTRYRKPSVPRST-LTPGTSRPGSRAGSRAGS 301 SG G+R KPSV +T TP + S + S A S Sbjct: 773 SGSGSRCSKPSVTSTTPPTPASLSSSSSSSSSASS 807 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.6 bits (51), Expect = 2.6 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = +2 Query: 449 TPNGSRPRT---PTGYLTPASGRQRTPSGSTTP--VRSGQQTAVSRLLRKP 586 TP+G+ P+T PTG P SG + S P V+ G Q+ + +L +P Sbjct: 365 TPSGTEPKTPTSPTGPSGPGSGHRSHDSFVLFPRKVKVG-QSKILLILHEP 414 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.6 bits (51), Expect = 2.6 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 Query: 254 PGTSRPGSRAGSRAGSKPPSRHGSNLSLDSTDDATTPSRIP 376 P TSRP S + G PPS + S+D +D R+P Sbjct: 328 PQTSRPPSGNDNMGGGPPPS--SATPSVDDDEDVVI-GRLP 365 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +2 Query: 206 LGTRYRKPSVPRSTLTPGTSRPGSRAGSRAGSKPPSRHGSNLSLDSTDDATTPSRI 373 L + ++ +T PGT+ P + + A +PP+ +++ +T + PS + Sbjct: 51 LALEQQSAAISTNTAAPGTAGPNAATVTAATPQPPA---ASMPPSTTTNTQIPSMV 103 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +2 Query: 341 STDDATTPSRIPMRKVTNTKTSIARAAANASKLGVSTPNGSRPRTPTGYLTPASGRQRTP 520 +T +ATT +R P T+ T+ ++ + +TP + P T + T + + P Sbjct: 121 TTTEATTTTRFPTTTTTSAPTTPSQ--WTDPTITTTTPVWTDPTTWSAPTTTTTWSDQPP 178 Query: 521 SGSTT 535 +TT Sbjct: 179 PPTTT 183 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +2 Query: 341 STDDATTPSRIPMRKVTNTKTSIARAAANASKLGVSTPNGSRPRTPTGYLTPASGRQRTP 520 +T +ATT +R P T+ T+ ++ + +TP + P T + T + + P Sbjct: 121 TTTEATTTTRFPTTTTTSAPTTPSQ--WTDPTITTTTPVWTDPTTWSAPTTTTTWSDQPP 178 Query: 521 SGSTT 535 +TT Sbjct: 179 PPTTT 183 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 7.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 377 MRKVTNTKTSIARAAANASKLGVSTPNGSRPRTPT 481 MR+ + + AAA A+K G S+ + P TPT Sbjct: 1040 MREKRASHAATLAAAAAATKGGESSEQPTTPVTPT 1074 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 549 PDRTGVVLPDGV 514 PD TG+VLP G+ Sbjct: 378 PDSTGIVLPKGL 389 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 324 QIYPWIVQTMRQRRPAFP*GKSR 392 ++YPW Q+ +RP F G +R Sbjct: 42 KLYPWDTQSTYIKRPPFFDGMTR 64 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 511 KDPIGQHDAGAVGTADRGVSS 573 K P +H+ G +GT RG +S Sbjct: 1427 KSPSDKHNPGTLGTDSRGGNS 1447 >AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein S18 protein. Length = 46 Score = 23.0 bits (47), Expect = 7.8 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 553 LSRPHRRRAAR--WGPLSSTSRRQVTGRRPRTGAVRR 449 L R H R R WG + TGRR RT V + Sbjct: 8 LKRIHAHRGMRHYWGLRVRGQHTKTTGRRGRTVGVSK 44 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 242 STLTPGTSRPGSRAGSRAGSKPPSRHGSNLSLDSTDDATTP 364 ST+ PGT+ + ++PP+ N + ST P Sbjct: 418 STVAPGTTTTTPTGANPGTTQPPTSDAPNHTTTSTTTEGNP 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,271 Number of Sequences: 2352 Number of extensions: 14056 Number of successful extensions: 62 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -