BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0304 (774 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0125 - 6852470-6852481,6852641-6853086,6853178-6853781,685... 29 3.1 06_01_0441 + 3130906-3131424,3131847-3132269 29 5.4 04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506... 28 7.2 11_01_0404 + 3071412-3071464,3073572-3074970 28 9.5 >05_02_0125 - 6852470-6852481,6852641-6853086,6853178-6853781, 6853970-6854187,6854283-6854437,6854561-6854772 Length = 548 Score = 29.5 bits (63), Expect = 3.1 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 3/80 (3%) Frame = +3 Query: 465 SDKACRACSTVLPSLKTFLS*L*SRIATTLTFTMSVVKAMKARNI---CCGLKQRLTKLS 635 S C TV PSL T LS ++I + +S++ +++ N+ C ++ + LS Sbjct: 351 SQALCVLAGTV-PSLTT-LSLAHTKIDDSALLYISMMPSLRILNLSRTCFMMENSVKVLS 408 Query: 636 LNMIHKLKFDRSINMKTKQL 695 L+ + +LK+ S+N+ QL Sbjct: 409 LSALEELKYLESLNLNNTQL 428 >06_01_0441 + 3130906-3131424,3131847-3132269 Length = 313 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 234 YWLVFMVMHEHGCS-VYSRSCMMRC 163 YWL+F +H HG V + SC ++C Sbjct: 278 YWLMFYRLHAHGIHLVLNLSCALQC 302 >04_04_0964 - 29749624-29749649,29749742-29749945,29750036-29750634, 29750742-29750826,29750914-29751562,29751568-29751643, 29753891-29753957,29754097-29754998,29756579-29756790 Length = 939 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 426 VGGVFHNTDRSISFMQRVVALHDITVASL 340 +GGVFHN D +SF + D TVAS+ Sbjct: 737 MGGVFHNEDGVLSFFIGSLGNVDQTVASI 765 >11_01_0404 + 3071412-3071464,3073572-3074970 Length = 483 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 178 LHDALLLVQHGKIDLHSHDHESH 110 + D + L QHGKI H H H H Sbjct: 108 ISDGVQLGQHGKIAHHHHHHRHH 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,392,069 Number of Sequences: 37544 Number of extensions: 373827 Number of successful extensions: 794 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -