BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0304 (774 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) 31 0.78 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 30 2.4 SB_43421| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_34940| Best HMM Match : 7tm_1 (HMM E-Value=0.033) 29 4.2 SB_5550| Best HMM Match : BofA (HMM E-Value=3.3) 29 5.5 SB_17292| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) 28 9.6 >SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) Length = 1362 Score = 31.5 bits (68), Expect = 0.78 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 292 EYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSADKHNGFNAV 450 +Y D +TG + TR G V Y ++ + S+ + E+SAD+ NG+ + Sbjct: 1202 KYMHGDTYTGHWRDN--TRHGHGVMSYGAMSSSAASVYIGEWSADRKNGYGTM 1252 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/75 (22%), Positives = 27/75 (36%) Frame = +1 Query: 244 DQPHHEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 423 D +DY + + A YK + D + HE D D + ++ + A Sbjct: 568 DNRASDDYTTNDEEANNYKTNNNAPDDDTTNHEATDNDAPDHNTTYYDTPDDYTTNDEEA 627 Query: 424 DKHNGFNAVVKHTAP 468 D + N H AP Sbjct: 628 DNYKTNNDTTNHEAP 642 >SB_43421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 715 Score = 29.1 bits (62), Expect = 4.2 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = +2 Query: 86 HPSLLLDTM*LMVMGMKVNLTMLYQ*QRIMQLRLYTLHPCSCITMNTSQYIMETSLTMKI 265 H L L M LM+ M + LTM+ ++ + T + +T +M T +TM + Sbjct: 436 HFQLKLTMMLLMMTSMTMMLTMMTSMTMMLTMMTLTTMMLTMMTSMKIMLMMMTLMTMML 495 Query: 266 MM--LIPNMHLNTKSKTLTL 319 MM L+P M + T+ L Sbjct: 496 MMMTLMPMMLMMMTLMTMML 515 >SB_34940| Best HMM Match : 7tm_1 (HMM E-Value=0.033) Length = 220 Score = 29.1 bits (62), Expect = 4.2 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = -1 Query: 276 MSIIIFMVRLVSMMYWLVFMVMHEHG 199 +++ +F+V ++S+ WL F+++HE G Sbjct: 104 LAVTLFIVTVLSLAAWLPFIIVHEVG 129 >SB_5550| Best HMM Match : BofA (HMM E-Value=3.3) Length = 203 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 309 VFDFVFKCIFGMSIIIFMVRLVSMMYWLVF 220 VF VF +FG+ + ++ + +++WLVF Sbjct: 122 VFGLVFGLVFGIDFGLVLLLVFGLVFWLVF 151 >SB_17292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 439 FNAVVKHTAPTKHAEPVQQYYH 504 FNAV+ P K A PVQ ++H Sbjct: 4 FNAVIPTATPPKKAMPVQTFFH 25 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 364 KGYYSLHEADGSIRVVEYSADKHNGFNAVVKHTAP 468 KG Y H+ DG R +EY + G+ HT P Sbjct: 1742 KGSYDTHDVDGRRRTIEYYSGTPQGY-LPPAHTRP 1775 >SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 241 GDQPHHEDYDAHPKYAFEYKIEDPHTGD 324 GD ++Y A+ A+ Y +EDP T D Sbjct: 1049 GDHISDDEYRAYEDGAYTYPVEDPFTDD 1076 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/59 (22%), Positives = 24/59 (40%) Frame = -3 Query: 307 LRFCIQMHIWDEHHNLHGEAGLHDVLARVHGDARARVQRV*SELHDALLLVQHGKIDLH 131 LR C Q + E H H +HD++ D R ++ ++ D + + +H Sbjct: 342 LRKCAQEGLTTEAHRGHVRCKMHDIITCKMQDVRCKMSDARCQMQDVRCKMSDARCQMH 400 >SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) Length = 971 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 241 GDQPHHEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGS 399 G +P+ D + FE+K + L H R G+ ++ Y H ADGS Sbjct: 542 GVEPNDSDDGLFKLHNFEFKQSNECLAHLG--HSARSGNNIRVYLPSHSADGS 592 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,525,199 Number of Sequences: 59808 Number of extensions: 448125 Number of successful extensions: 1023 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -