BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0304 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14070.1 68417.m02172 AMP-binding protein, putative similar t... 29 3.4 At3g19360.1 68416.m02456 zinc finger (CCCH-type) family protein ... 29 4.5 >At4g14070.1 68417.m02172 AMP-binding protein, putative similar to AMP-binding protein [gi:1617272] from Brassica napus; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-CoA synthetase-like protein GI:20799730 Length = 727 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = +1 Query: 274 HPKYAFEYKIEDPHTGDL-----KSQHETRDGDVVKGYY 375 HP + E+KI DP T ++ K + R V+KGYY Sbjct: 520 HPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYY 558 >At3g19360.1 68416.m02456 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 386 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 277 DEHHNLHGEAGLHDVLARVHGDARARVQRV 188 D+ H HG+A LH+ + RV G+A V V Sbjct: 288 DKCHFAHGQAELHNSVGRVEGEAMNAVASV 317 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,622,717 Number of Sequences: 28952 Number of extensions: 301540 Number of successful extensions: 696 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -