BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0302 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 9.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 9.6 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 398 WTKLLRFFKVKKTEKILRRYYFL 330 W++ L K+ K KI + Y+L Sbjct: 80 WSEFLANLKLLKGRKIRKNLYYL 102 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +2 Query: 440 SFAINSGNDFMGSLNDFSISSEKYSFYYVYFM*KYPI 550 SFA+ + ++ +L ++++S +FYY+ M P+ Sbjct: 40 SFAVTFFSAWICALVNYNVSEISENFYYLPAMSTGPL 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,289 Number of Sequences: 336 Number of extensions: 3655 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -