BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0301 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M... 26 5.9 SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 26 5.9 >SPBC83.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 161 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 185 KVYKLLISINYSRISTTAGP 126 K YK +++INY +S+ +GP Sbjct: 33 KFYKCVLTINYISVSSMSGP 52 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 25.8 bits (54), Expect = 5.9 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +1 Query: 160 IEIKSLYTLFMIVFH-----SSIITNFAKATL*KNINKDKQYLIYSQFDHKRQEQKF 315 +++ L +LF I F+ +S+++N A ATL + + YL Y HK++ F Sbjct: 130 MKLPILISLFRICFNLHNSKNSVVSNAAAATLRQIVILVFDYLDYDTLAHKQEADLF 186 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,732,706 Number of Sequences: 5004 Number of extensions: 53224 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -