BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0301 (686 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77134-2|CAB00873.1| 877|Caenorhabditis elegans Hypothetical pr... 28 7.2 AC006795-1|AAF59492.2| 435|Caenorhabditis elegans Hypothetical ... 28 7.2 >Z77134-2|CAB00873.1| 877|Caenorhabditis elegans Hypothetical protein R09H10.4 protein. Length = 877 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 276 LFSI*PQTSRTKV*QQIVCMCVCFLY*FNVF 368 L +I P T T V I M VCFL+ +NVF Sbjct: 675 LETILPATISTSVCTLICMMIVCFLFMYNVF 705 >AC006795-1|AAF59492.2| 435|Caenorhabditis elegans Hypothetical protein Y50D4B.7 protein. Length = 435 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 174 FVHFVYDCIS*FYNHKFRQGYTIKKY 251 +V F YD IS Y+HK + G +++ Y Sbjct: 258 YVKFTYDIISNTYSHKRQNGSSLEPY 283 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,127,261 Number of Sequences: 27780 Number of extensions: 299611 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -