BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0300 (715 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29580.1 68417.m04217 cytidine deaminase, putative / cytidine... 28 7.1 At3g46510.1 68416.m05049 armadillo/beta-catenin repeat family pr... 27 9.3 >At4g29580.1 68417.m04217 cytidine deaminase, putative / cytidine aminohydrolase, putative identical to cytidine deaminase homolog DesB [Arabidopsis thaliana] GI:4836444, cytidine deaminase 9 (CDA9) [Arabidopsis thaliana] GI:5080715; similar to cytidine deaminase (CDD) [Arabidopsis thaliana] GI:3046700; contains Pfam profile PF00383: Cytidine and deoxycytidylate deaminase zinc-binding Length = 298 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 175 IHSYLPENYNYSYHEVAMYIFYIKYIIERREEALHLTS*FPL 300 + +YLP+ Y Y+EV Y F+ + + E R L L + P+ Sbjct: 140 LSTYLPQKYLSLYNEVPKY-FFARLLDENRNNGLTLINPNPI 180 >At3g46510.1 68416.m05049 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 660 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -3 Query: 617 KNVDMNGYSPSLREDNKSVNVIEFPTLSFSDIAISSRVLN*G 492 K+ D++ Y P L K ++++E P L+ +A+ V + G Sbjct: 161 KSSDVDAYQPVLERVAKKLHLMEIPDLAQESVALHEMVASSG 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,803,398 Number of Sequences: 28952 Number of extensions: 230486 Number of successful extensions: 513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -