BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0299 (740 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC569.02c |||S. pombe specific UPF0321 family protein 2|Schizo... 31 0.17 SPCP20C8.02c |||S. pombe specific UPF0321 family protein 1|Schiz... 28 1.2 >SPCC569.02c |||S. pombe specific UPF0321 family protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 113 Score = 31.1 bits (67), Expect = 0.17 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 380 IIALFIILC-YIKTLYANFNLTVCFPAKIPVIKTFFI*HLTSHHNLVSF 237 ++ LF I C +IK + A NLT AK+P + +LT H +V F Sbjct: 1 MLLLFCICCAFIKLVLAEVNLTFVDYAKLPPKYAELLANLTDQHGMVLF 49 >SPCP20C8.02c |||S. pombe specific UPF0321 family protein 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 111 Score = 28.3 bits (60), Expect = 1.2 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -1 Query: 380 IIALFIILC-YIKTLYANFNLTVCFPAKIPVIKTFFI*HLTSHHNLVSF 237 ++ LF I C +IK + A NLT AK+P + +L H L+ F Sbjct: 1 MLLLFCICCVFIKLVLAEVNLTFVDYAKLPPNYAELLANLIDQHGLMLF 49 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,840,065 Number of Sequences: 5004 Number of extensions: 58395 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -