BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0294 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0936 - 32875479-32875573,32875794-32876028,32877752-328778... 29 4.8 >02_05_0936 - 32875479-32875573,32875794-32876028,32877752-32877848, 32878863-32878927,32879506-32879571,32879735-32879842, 32880169-32880303,32880582-32880647,32881172-32881222, 32881312-32881386,32881834-32881896,32882694-32882783, 32882903-32883100,32883189-32883315,32883482-32884100, 32884228-32884265,32884651-32884718,32885056-32885100, 32885243-32885302,32885510-32885593,32885677-32885868, 32887361-32887663 Length = 959 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 144 ILVPVLLNNVINKCPAIMLAVNRTAKVPGRIIFLMVSIITINGIKI*GVP 293 +L+PVL N++++ A + +N+T+ V R++ +V N IK VP Sbjct: 651 LLIPVLPNDMMDFLDAPVPYINKTSDVHSRLVNAVVIDANKNQIKSTSVP 700 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,776,882 Number of Sequences: 37544 Number of extensions: 127751 Number of successful extensions: 223 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -