BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0293 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 23 1.9 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 5.8 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 7.7 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 321 PGYENYGDQNRTSMSHEMRYAPDCACHTKCVI 226 P ++ D+N ++ + APDC T+CV+ Sbjct: 139 PDCKDESDENSCTVETDPNRAPDCD-PTQCVL 169 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 5.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 432 VFFFFFYIQ*TPVVRRSGHTHFFFWSLL 349 + F F Y + +R +FFWSLL Sbjct: 549 IVFAFCYCYYSISIRPISTLGWFFWSLL 576 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 20.6 bits (41), Expect = 7.7 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 58 EIVLYYDNTIHYR 96 ++V YYD+ H+R Sbjct: 25 KVVCYYDSKSHFR 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,814 Number of Sequences: 336 Number of extensions: 2431 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -