BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0293 (475 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 32 0.28 SB_36566| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_49559| Best HMM Match : Ion_trans_2 (HMM E-Value=0.013) 29 1.5 SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) 27 7.9 SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 31.9 bits (69), Expect = 0.28 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 166 VSLIIVFSYIC*SFVLCLVNLLIICSVSCCRNIELFLVLFRLI 38 VSL I+ FVLC + C+V+CC LF VL+ ++ Sbjct: 93 VSLYILRVMFVSLFVLCTCHRACSCNVACCVRAMLFFVLYCIV 135 >SB_36566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 327 YM*IDSKGVNSKKKSVCVRSDARLEFTGY 413 Y D+KG+N +++V V+ DA+++ GY Sbjct: 714 YNHFDTKGLNENRETVSVKVDAKIDVKGY 742 >SB_49559| Best HMM Match : Ion_trans_2 (HMM E-Value=0.013) Length = 201 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 166 VSLIIVFSYIC*SFVL-CLVNLLIICSVSCCRNI 68 V + + F Y VL CLVNLL++CS RN+ Sbjct: 131 VGVFLAFPYFTGFCVLACLVNLLVLCSEKGYRNV 164 >SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) Length = 899 Score = 27.1 bits (57), Expect = 7.9 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 220 TCDNAFRVTCAIRRITHFV-*HASTILVPIIFIPRAYICKSIL 345 TC +AF IRRI F+ A+ LV + I R C S+L Sbjct: 556 TCQSAFYSIFNIRRIRKFISKDAAKTLVQALVISRLDYCNSLL 598 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = -1 Query: 142 YIC*SFVLCLVNLLIICS 89 Y+C + V+CL+N+L+ C+ Sbjct: 871 YLCGNMVMCLLNMLLSCA 888 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,228,208 Number of Sequences: 59808 Number of extensions: 304471 Number of successful extensions: 712 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -