BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0293 (475 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051673-1|AAK93097.1| 470|Drosophila melanogaster LD22579p pro... 28 7.4 AE014134-2638|AAF53484.1| 470|Drosophila melanogaster CG4148-PA... 28 7.4 >AY051673-1|AAK93097.1| 470|Drosophila melanogaster LD22579p protein. Length = 470 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 6 PTHDWVYWI*KIKRNNTRNSSILRQHDTLQIINK 107 PT DW+YW R++ R D ++II+K Sbjct: 4 PTSDWIYWCRLCARDDVVYKVRERDDDLVRIISK 37 >AE014134-2638|AAF53484.1| 470|Drosophila melanogaster CG4148-PA protein. Length = 470 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 6 PTHDWVYWI*KIKRNNTRNSSILRQHDTLQIINK 107 PT DW+YW R++ R D ++II+K Sbjct: 4 PTSDWIYWCRLCARDDVVYKVRERDDDLVRIISK 37 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,609,372 Number of Sequences: 53049 Number of extensions: 423753 Number of successful extensions: 1222 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1222 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1622204766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -