BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0293 (475 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37450.1 68418.m04507 leucine-rich repeat transmembrane prote... 28 3.7 At4g10370.1 68417.m01702 DC1 domain-containing protein contains ... 28 3.7 At2g42150.1 68415.m05217 DNA-binding bromodomain-containing prot... 27 4.9 At5g06040.1 68418.m00669 self-incompatibility protein-related 27 8.6 At5g06030.1 68418.m00668 self-incompatibility protein-related si... 27 8.6 >At5g37450.1 68418.m04507 leucine-rich repeat transmembrane protein kinase, putative Length = 935 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 387 RSGHTHFFFWSLLL*NRFTYIGPGYE 310 + G+TH F+ SL + F Y+ P YE Sbjct: 498 KDGNTHIFYSSLCIKRVFIYVTPVYE 523 >At4g10370.1 68417.m01702 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 687 Score = 27.9 bits (59), Expect = 3.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 217 VTCDNAFRVTCAIRRITHFV*HASTILVPIIFIP 318 +TC+ + CA+R++ F+ H + P+ F P Sbjct: 201 LTCNLSMHPVCAMRKVPFFIDHPKSHPHPLTFFP 234 >At2g42150.1 68415.m05217 DNA-binding bromodomain-containing protein contains Pfam domains, PF00439: Bromodomain and PF00249: Myb-like DNA-binding domain Length = 631 Score = 27.5 bits (58), Expect = 4.9 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 334 KSILKE*TPKKKVCVSAPTHDWSLLDIKKKKKNSRGG-PVPNSP 462 +S +K+ ++++ P + LD+++KK+ S G PVPN P Sbjct: 114 QSKVKQLEEEREMSFIKPDTETENLDLERKKERSDSGEPVPNPP 157 >At5g06040.1 68418.m00669 self-incompatibility protein-related Length = 111 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = -1 Query: 163 SLIIVFSYIC*SFVLCLVNLLIICSVS 83 S+I + SY+C F++ +V + +ICS++ Sbjct: 5 SIINLNSYVCSIFIMSIVVISLICSLA 31 >At5g06030.1 68418.m00668 self-incompatibility protein-related simlar to self-incompatibility [Papaver rhoeas] GI:3097260 Length = 150 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 163 SLIIVFSYIC*SFVLCLVNLLIICS 89 S I ++SY+C F++ +V + +ICS Sbjct: 5 SKINLYSYVCSIFIMSIVVISLICS 29 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,327,414 Number of Sequences: 28952 Number of extensions: 200190 Number of successful extensions: 453 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -