BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0292 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) 28 4.1 SB_56544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_42025| Best HMM Match : HTH_AraC (HMM E-Value=0.038) 27 9.5 >SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) Length = 1624 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -3 Query: 444 RRPFQFHQDRWASKGSAKRGGIC*QLPERLRRRPNNSR 331 +RPF + DRWA G A GG+ E RRR + R Sbjct: 155 KRPFLYRGDRWAGHGGA--GGV----HEAARRRDHRKR 186 >SB_56544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 270 RIFSAGRDSDPVVDS-FAKQLLLSC*VSFGGARAVVSKSHPSWLS 401 +I++ G +PV D F QL +S SFGG R+ +++ +PS +S Sbjct: 724 KIYNLG-SKNPVFDGHFTNQLAIS---SFGGERSDIARLYPSPIS 764 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 394 QEGWDLLTTARAPPKET*QLKSNCFANESTTGSESRPAEK 275 Q+ W L A P + Q+ CF E TT + +EK Sbjct: 1405 QDKWFLFNDAEVKPFDPSQIAGECFGGEMTTKTYDVVSEK 1444 >SB_42025| Best HMM Match : HTH_AraC (HMM E-Value=0.038) Length = 318 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 52 ADYSPNPDHAGASHRRRPRHVLTDPSDPITFALDAF 159 A YSP + S R PRH + P+ TFA+ F Sbjct: 230 ARYSPRKTNKTDSIRTFPRHERSSPTGSYTFAVAEF 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,960,012 Number of Sequences: 59808 Number of extensions: 281730 Number of successful extensions: 768 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -