BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0290 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 1.1 AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. 25 2.5 AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. 25 2.5 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 25 2.5 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 3.3 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 5.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 5.8 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.8 bits (54), Expect = 1.1 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 301 GVSGELFWSFNSLIRIHFNSTPDSKAIWM 387 G+SG++F+S + + + T D + +WM Sbjct: 459 GISGQVFFSLRQQGQGNGSKTADERGVWM 487 >AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 179 VGYSDATTTLTSLPEIRNLWH 117 +G S +TTT S+P+ WH Sbjct: 133 IGSSGSTTTKESVPDTITAWH 153 >AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 179 VGYSDATTTLTSLPEIRNLWH 117 +G S +TTT S+P+ WH Sbjct: 133 IGSSGSTTTKESVPDTITAWH 153 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 24.6 bits (51), Expect = 2.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 600 RCMLNQSKAIPV*QINTRCATSFSENIIGAL 508 RCM+N+ K PV ++ A F+ +IIG++ Sbjct: 156 RCMMNEIKTSPVVEMKDLLA-RFTTDIIGSV 185 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 24.2 bits (50), Expect = 3.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -1 Query: 308 DTPQPDTVRDTLAYIPDRSRYNDLFRTLNPLKARNTSDASDSAV 177 D P DT+ D AY DR LF+ + SD SD V Sbjct: 115 DQPDADTLGDVAAYARDRLN-GPLFQYALASALLHRSDTSDVPV 157 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 5.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 173 YSDATTTLTSLPEIRNLW 120 Y+ T T+T+LP++ + W Sbjct: 49 YNVTTKTMTALPDLEDYW 66 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 5.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 173 YSDATTTLTSLPEIRNLW 120 Y+ T T+T+LP++ + W Sbjct: 49 YNVTTKTMTALPDLEDYW 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,312 Number of Sequences: 2352 Number of extensions: 9225 Number of successful extensions: 28 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -