BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0289 (483 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061347-1|AAL28895.1| 341|Drosophila melanogaster LD27878p pro... 28 7.7 AF005629-1|AAD01252.1| 1167|Drosophila melanogaster adenylyl cyc... 28 7.7 AE014134-3524|AAX52676.1| 341|Drosophila melanogaster CG1506-PC... 28 7.7 AE014134-3523|AAN11131.1| 1167|Drosophila melanogaster CG1506-PB... 28 7.7 AE014134-3522|AAF57223.1| 1167|Drosophila melanogaster CG1506-PA... 28 7.7 >AY061347-1|AAL28895.1| 341|Drosophila melanogaster LD27878p protein. Length = 341 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 243 LLF*HLGHGCVNTSMLLELFIGYLHWTANL 332 L+F L GC+ + L L +GY HW + L Sbjct: 181 LIFLGLSIGCITYFICLSLPVGYSHWDSLL 210 >AF005629-1|AAD01252.1| 1167|Drosophila melanogaster adenylyl cyclase isoform DAC39E protein. Length = 1167 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 243 LLF*HLGHGCVNTSMLLELFIGYLHWTANL 332 L+F L GC+ + L L +GY HW + L Sbjct: 181 LIFLGLSIGCITYFICLSLPVGYSHWDSLL 210 >AE014134-3524|AAX52676.1| 341|Drosophila melanogaster CG1506-PC, isoform C protein. Length = 341 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 243 LLF*HLGHGCVNTSMLLELFIGYLHWTANL 332 L+F L GC+ + L L +GY HW + L Sbjct: 181 LIFLGLSIGCITYFICLSLPVGYSHWDSLL 210 >AE014134-3523|AAN11131.1| 1167|Drosophila melanogaster CG1506-PB, isoform B protein. Length = 1167 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 243 LLF*HLGHGCVNTSMLLELFIGYLHWTANL 332 L+F L GC+ + L L +GY HW + L Sbjct: 181 LIFLGLSIGCITYFICLSLPVGYSHWDSLL 210 >AE014134-3522|AAF57223.1| 1167|Drosophila melanogaster CG1506-PA, isoform A protein. Length = 1167 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 243 LLF*HLGHGCVNTSMLLELFIGYLHWTANL 332 L+F L GC+ + L L +GY HW + L Sbjct: 181 LIFLGLSIGCITYFICLSLPVGYSHWDSLL 210 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,850,319 Number of Sequences: 53049 Number of extensions: 280518 Number of successful extensions: 773 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1684597257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -