BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0274 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 163 9e-41 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 62 6e-10 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 62 6e-10 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 62 6e-10 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 59 3e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 3e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 55 6e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 3e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 52 3e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 48 1e-05 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 4e-05 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 40 0.003 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 40 0.003 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 40 0.003 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 40 0.003 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 40 0.003 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 40 0.003 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 40 0.003 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 40 0.003 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 40 0.003 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 40 0.003 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 40 0.003 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 40 0.003 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 40 0.003 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 40 0.003 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 36 0.031 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 36 0.031 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 36 0.031 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 36 0.031 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 36 0.031 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 36 0.031 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 36 0.031 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 36 0.031 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 36 0.031 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 36 0.031 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 36 0.031 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 36 0.031 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 36 0.031 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 36 0.031 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 36 0.031 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 36 0.031 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 36 0.031 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 36 0.031 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 36 0.031 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 36 0.031 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 36 0.031 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 36 0.031 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 36 0.031 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 36 0.031 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 36 0.031 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 36 0.031 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 36 0.031 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 36 0.031 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 36 0.031 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 36 0.031 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 36 0.031 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 36 0.031 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 36 0.031 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 36 0.031 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 36 0.031 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 36 0.031 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 36 0.031 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 36 0.031 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 36 0.031 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 36 0.031 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 36 0.031 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 36 0.031 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 36 0.031 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 36 0.031 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 36 0.031 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 36 0.031 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 36 0.031 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 36 0.031 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 36 0.031 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.031 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 36 0.031 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 36 0.031 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 36 0.031 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 36 0.031 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 36 0.031 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 36 0.031 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 36 0.031 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 36 0.031 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 36 0.031 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 36 0.031 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 36 0.031 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 36 0.031 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 36 0.031 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 36 0.031 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 36 0.031 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 36 0.031 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 36 0.031 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 36 0.031 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 36 0.031 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 36 0.031 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 36 0.041 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 35 0.072 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.072 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 35 0.072 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 35 0.072 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 35 0.072 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.072 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 35 0.072 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 35 0.072 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 35 0.072 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 35 0.072 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 35 0.072 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 35 0.072 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 35 0.072 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 35 0.072 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 35 0.072 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 163 bits (397), Expect = 9e-41 Identities = 71/121 (58%), Positives = 94/121 (77%) Frame = +3 Query: 3 QKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFGSKKELAA 182 + V IPD + V VKSR+VTV GPRG LKRNF+HL +++ V ++V+ WF S+KELA Sbjct: 564 ETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKDKVRVDVWFASRKELAC 623 Query: 183 VRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMA 362 V+T+ +H+ENMIKGV G++YKMRAVYAHFPIN E +++E+RNFLGEKY+RRV+M Sbjct: 624 VKTIITHIENMIKGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKYVRRVRMR 683 Query: 363 P 365 P Sbjct: 684 P 684 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 65.7 bits (153), Expect = 3e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 694 RQGFPSHDVVKRRPVNCNTTHYRANW 617 RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 77 RQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 694 RQGFPSHDVVKRRPVNCNTTHYRANW 617 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.1 bits (144), Expect = 4e-10 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 691 QGFPSHDVVKRRPVNCNTTHYRANW 617 +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 35 KGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 688 GFPSHDVVKRRPVNCNTTHYRANW 617 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 688 GFPSHDVVKRRPVNCNTTHYRANW 617 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 688 GFPSHDVVKRRPVNCNTTHYRANW 617 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 688 GFPSHDVVKRRPVNCNTTHYRANW 617 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 688 GFPSHDVVKRRPVNCNTTHYRANW 617 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRANW 617 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRANW 617 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRANW 617 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRANW 617 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRANW 617 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 >SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 58.4 bits (135), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 450 ALIQQSTTVKNKDIRKFLDGLYVSEKTTVV 539 ALIQQST VKNKDIRKFLDG+YVSEKTT+V Sbjct: 2 ALIQQSTKVKNKDIRKFLDGVYVSEKTTIV 31 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 617 PIRPIVSRITIHWPSFYNVVTGKTLA 694 PIRPIVSRITIHWP+FYN TGKTLA Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLA 64 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 620 IRPIVSRITIHWPSFYNVVTGKTLA 694 +RP+VSRITIHW SFYNVVTGKTLA Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLA 57 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 676 HDVVKRRPVNCNTTHYRANW 617 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 691 QGFPSHDVVKRRPVNCNTTHYRAN 620 +GFPSHD KRRPVNCNTTHYRAN Sbjct: 74 RGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 676 HDVVKRRPVNCNTTHYRANW 617 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 685 FPSHDVVKRRPVNCNTTHYRAN 620 F SHDVVKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +2 Query: 626 PIVSRITIHWPSFYNVVTGKTLA 694 P +SRITIHWPSFYNVVTGKTLA Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLA 99 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTLA Sbjct: 2 SRITIHWPSFYNVVTGKTLA 21 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKTLA 694 SRITIHWPSFYNVVTGKTL+ Sbjct: 2 SRITIHWPSFYNVVTGKTLS 21 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +2 Query: 617 PIRPIVSRITIHWPSFYNVVT 679 PIRPIVS ITIHWPSFYN VT Sbjct: 41 PIRPIVSHITIHWPSFYNGVT 61 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGK 685 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGK 685 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGK 685 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGK 685 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 620 IRPIVSRITIHWPSFY 667 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 253 TPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 921 TPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 33 TPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 408 TPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 257 TPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 324 TPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 390 TPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 82 TPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 64 TPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 300 TPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 284 TPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 273 TPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 298 TPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 482 TPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 151 TPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 317 TPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 167 TPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 360 TPGFSQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 27 TPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 226 TPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 618 TPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 254 TPGFSQSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 63 TPGFSQSRRCKTTASEL 79 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 94 TPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 532 TPGFSQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 115 TPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 423 TPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 27 TPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TPGFSQSRRCKTTASEL Sbjct: 216 TPGFSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL*YDSL 630 TPGFSQSRRCKTTASE D L Sbjct: 41 TPGFSQSRRCKTTASEFPGDPL 62 Score = 34.7 bits (76), Expect = 0.072 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 652 LAVVLQRRDWENPG 693 LAVVLQRRDWENPG Sbjct: 85 LAVVLQRRDWENPG 98 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 650 HWPSFYNVVTGKTLA 694 HWPSFYNVVTGKTLA Sbjct: 62 HWPSFYNVVTGKTLA 76 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 650 HWPSFYNVVTGKTLA 694 HWPSFYNVVTGKTLA Sbjct: 5 HWPSFYNVVTGKTLA 19 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 650 HWPSFYNVVTGKTLA 694 HWPSFYNVVTGKTLA Sbjct: 57 HWPSFYNVVTGKTLA 71 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 635 SRITIHWPSFYNVVTGKT 688 SRITIHWPSFYNV+ KT Sbjct: 2 SRITIHWPSFYNVMLAKT 19 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTASE 648 TPGFSQSRRCKTTASE Sbjct: 563 TPGFSQSRRCKTTASE 578 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.1 bits (82), Expect = 0.014 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 650 HWPSFYNVVTGKTL 691 HWPSFYNVVTGKTL Sbjct: 5 HWPSFYNVVTGKTL 18 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 509 TPGFSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 179 TPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 256 TPGFSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 400 TPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 102 TPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 683 TPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 189 TPGFSQSRRCKTTAS 203 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 241 TPGFSQSRRCKTTAS 255 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 35.9 bits (79), Expect = 0.031 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -1 Query: 695 TPGFSQSRRCKTTASEL 645 TP FSQSRRCKTTASEL Sbjct: 33 TPVFSQSRRCKTTASEL 49 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 592 TPGFSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 439 TPGFSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 66 TPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 822 TPGFSQSRRCKTTAS 836 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 35.9 bits (79), Expect = 0.031 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 650 HWPSFYNVVTGKTLA 694 HWPSFYN VTGKTLA Sbjct: 5 HWPSFYNDVTGKTLA 19 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 483 TPGFSQSRRCKTTAS 497 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 102 TPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 48 TPGFSQSRRCKTTAS 62 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 404 TPGFSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 1138 TPGFSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 329 TPGFSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 143 TPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 53 TPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 15 TPGFSQSRRCKTTAS 29 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 27 TPGFSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 69 TPGFSQSRRCKTTAS 83 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 48 TPGFSQSRRCKTTAS 62 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 519 TPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 127 TPGFSQSRRCKTTAS 141 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.031 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 635 SRITIHWPSFYNVV 676 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 87 TPGFSQSRRCKTTAS 101 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 89 TPGFSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 83 TPGFSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 188 TPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 48 TPGFSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 225 TPGFSQSRRCKTTAS 239 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 161 TPGFSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 132 TPGFSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 88 TPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 56 TPGFSQSRRCKTTAS 70 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 695 TPGFSQSRRCKTTAS 651 TPGFSQSRRCKTTAS Sbjct: 34 TPGFSQSRRCKTTAS 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,422,628 Number of Sequences: 59808 Number of extensions: 424168 Number of successful extensions: 3916 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3915 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -