BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0271 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 27 0.32 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 27 0.32 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.3 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 5.2 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 23 9.0 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.5 bits (58), Expect = 0.32 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 234 YKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 377 Y++ K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 484 YRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.5 bits (58), Expect = 0.32 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 234 YKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 377 Y++ K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 484 YRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.4 bits (53), Expect = 1.3 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = +1 Query: 43 VVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQVQRLDSQESRWCRGEP*QGRD 222 V +L QQQ P ++ Q Q+ QQ + PP L+ QR Q + + + Q + Sbjct: 265 VPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQ 324 Query: 223 SQ*CTRKQR 249 Q ++Q+ Sbjct: 325 QQRQQQRQQ 333 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 358 SVR*WLAFNNLFTLYSDLLAPALN 287 +V+ WLA NN+ T+ L+P LN Sbjct: 163 TVQTWLADNNVKTMKWPALSPDLN 186 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 379 VVLQPSSAPRGPSKQKRLRQP 441 ++ +P R P+KQKR R P Sbjct: 98 ILPKPMRGRRDPNKQKRPRSP 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,551 Number of Sequences: 2352 Number of extensions: 11763 Number of successful extensions: 59 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -