BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0258 (799 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL157766-1|CAI13922.2| 4432|Homo sapiens spastic ataxia of Charl... 30 8.4 AF193556-1|AAF31262.1| 3829|Homo sapiens sacsin protein. 30 8.4 >AL157766-1|CAI13922.2| 4432|Homo sapiens spastic ataxia of Charlevoix-Saguenay (sacsin) protein. Length = 4432 Score = 30.3 bits (65), Expect = 8.4 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -1 Query: 262 LRSICVTQEYRKRKFLTTYNLLLPTRFFLILN 167 L S+ T + ++ KFLTTY+ L+P+R L +N Sbjct: 3012 LDSVLQTFDAKRPKFLTTYHELIPSRKDLFMN 3043 >AF193556-1|AAF31262.1| 3829|Homo sapiens sacsin protein. Length = 3829 Score = 30.3 bits (65), Expect = 8.4 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -1 Query: 262 LRSICVTQEYRKRKFLTTYNLLLPTRFFLILN 167 L S+ T + ++ KFLTTY+ L+P+R L +N Sbjct: 2409 LDSVLQTFDAKRPKFLTTYHELIPSRKDLFMN 2440 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,886,431 Number of Sequences: 237096 Number of extensions: 2656861 Number of successful extensions: 3709 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3709 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9813323168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -