BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0255 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0332 + 16465360-16465769,16465873-16466272,16466379-164664... 29 2.4 10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626... 29 3.1 10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721,160... 28 5.4 03_05_0902 + 28643395-28643708,28643830-28643921,28644342-286444... 28 5.4 03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001,100... 28 5.4 08_02_0446 - 17221514-17221626,17221960-17222035,17222381-172225... 28 7.2 01_05_0749 + 24890944-24891146,24891414-24891535,24891633-248917... 28 7.2 12_02_0191 + 15178717-15179045,15179147-15179546,15179624-151796... 27 9.5 02_03_0006 - 13868590-13869593,13869887-13870156,13870487-13871090 27 9.5 >11_04_0332 + 16465360-16465769,16465873-16466272,16466379-16466423, 16467113-16467139,16467201-16467266,16467889-16467950, 16468049-16468123,16468218-16468383,16468611-16468734, 16469737-16469843,16469992-16470102 Length = 530 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 175 TCLPMHYFHIYSSTKDDTFIPPIGIKV 95 +C +H I SS + DTFIPPI + V Sbjct: 144 SCEAVHLTDIQSSIECDTFIPPIDLSV 170 >10_08_0683 - 19860777-19861070,19861677-19861874,19862498-19862659, 19862763-19862911,19863089-19863236,19863317-19863385, 19863471-19863719,19863937-19864131,19864444-19864560, 19864978-19866537 Length = 1046 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 218 VRFFGACQVSGVYMDLPSHALFSYLQ*YKR*HIYSPN 108 + F G + G D PSH LF LQ + Y+PN Sbjct: 586 IAFVGGLDLCGGRYDTPSHPLFRSLQTVHKEDYYNPN 622 >10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721, 1604587-1604651,1604704-1604746,1605086-1605128, 1605874-1605955,1606270-1606464,1606567-1606721, 1611207-1611435,1611538-1611693,1612539-1613476, 1614946-1614967 Length = 1078 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 183 NPGYLASSEEANGRGRLLMS 242 +PG+L E+A GRGRL++S Sbjct: 663 SPGWLMEPEKAPGRGRLMLS 682 >03_05_0902 + 28643395-28643708,28643830-28643921,28644342-28644443, 28645135-28645185,28645267-28645328,28645664-28645754, 28645911-28645975,28646053-28646247,28646346-28646465, 28646630-28646700,28646839-28647064,28647474-28647524, 28647629-28647857,28648140-28648279,28648527-28648652 Length = 644 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = +2 Query: 26 KKINREDTFINKFVTNHFRGVSSNFYSYWGNKCVIFCTTVNMKIMHGKASPYKPRILGK 202 K N +++ NH R + SN SY C T+ ++H + K +L + Sbjct: 536 KGANNNTPANDRYQDNHLRRIGSNVSSYINMVCETLRNTIPKAVVHCQVKEAKRNLLNR 594 >03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001, 1008103-1008273,1008405-1008553,1008780-1008927, 1009015-1009083,1009168-1009416,1009516-1009710, 1009869-1009985,1010205-1011329 Length = 921 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 218 VRFFGACQVSGVYMDLPSHALFSYLQ*YKR*HIYSPN 108 V F G + G D P+H LF LQ + Y+PN Sbjct: 441 VAFVGGLDLCGGRYDTPTHPLFRSLQTLHKDDYYNPN 477 >08_02_0446 - 17221514-17221626,17221960-17222035,17222381-17222536, 17222645-17222723,17223858-17224087,17224938-17225076, 17225158-17225220,17226198-17226279,17226366-17226444, 17227046-17227225,17227331-17227590,17227704-17227806, 17227915-17228058,17228148-17228246 Length = 600 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 112 GE*MCHLLYYCKYENNAW 165 GE M H +Y+CK N+ W Sbjct: 141 GEGMLHAVYFCKSNNSTW 158 >01_05_0749 + 24890944-24891146,24891414-24891535,24891633-24891721, 24891813-24891848,24892268-24892367,24892524-24892566, 24892645-24892739,24892978-24893036,24893114-24893613, 24893691-24893772,24893864-24894429,24894520-24894655, 24894750-24894812,24894942-24895172,24895282-24895395 Length = 812 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 544 VGLPTPVAGALMMRIFVGMRN-NNVNFKCPAKRTDGYS 434 VGLPT + L+++ + N++FK AK T+GY+ Sbjct: 635 VGLPTLESRELILKTLLSKETVENIDFKELAKMTEGYT 672 >12_02_0191 + 15178717-15179045,15179147-15179546,15179624-15179668, 15180506-15180571,15181829-15181890,15182161-15182326, 15183384-15183507,15184177-15184283,15184395-15184505 Length = 469 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 172 CLPMHYFHIYSSTKDDTFIPPIGIKV 95 C +H I SS + DTFIPPI + + Sbjct: 118 CEAIHLTDIESSIECDTFIPPIDLSM 143 >02_03_0006 - 13868590-13869593,13869887-13870156,13870487-13871090 Length = 625 Score = 27.5 bits (58), Expect = 9.5 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 242 RHEKPPTSVRFFGACQVSGVYMDLPS-HALFSYLQ*YKR*HIYSPNRNKSL 93 RH PP VR G CQ V + PS H L ++ ++ +I +RN L Sbjct: 537 RHLTPPPIVRAAGQCQEDEVKLSEPSIHKLAVQVKKLRKENIELRDRNAEL 587 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,570,196 Number of Sequences: 37544 Number of extensions: 301441 Number of successful extensions: 650 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -