BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0255 (640 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2103|AAS64846.2| 300|Drosophila melanogaster CG33462-P... 29 4.0 >AE013599-2103|AAS64846.2| 300|Drosophila melanogaster CG33462-PA protein. Length = 300 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = -3 Query: 251 GKMRHEKPPTSVRFFGACQVSGVYMDLPSHALFSYLQ*YKR*HIYSPNRNKSLKK 87 G R+ + + R G CQ SG+ MDL S+A +++ R + S + N+SLKK Sbjct: 236 GSDRYVQLGIASRVKGQCQNSGILMDLLSYA--DWIKRVVRQYGPSTDMNRSLKK 288 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,840,532 Number of Sequences: 53049 Number of extensions: 541029 Number of successful extensions: 963 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2682985500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -