BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0252 (762 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 43 0.010 UniRef50_UPI000069E9B7 Cluster: UPI000069E9B7 related cluster; n... 36 0.83 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 36 1.1 UniRef50_Q8SX83 Cluster: Protein split ends; n=10; Eukaryota|Rep... 33 7.7 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +2 Query: 203 RRYCXXXXXXXSWVDELTVHLVLSGSWSP 289 +R+C WVDELT HLVLSG WSP Sbjct: 147 KRFCLSRFLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_UPI000069E9B7 Cluster: UPI000069E9B7 related cluster; n=1; Xenopus tropicalis|Rep: UPI000069E9B7 UniRef100 entry - Xenopus tropicalis Length = 370 Score = 36.3 bits (80), Expect = 0.83 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +1 Query: 28 IKGEPGKPSTEPLPAALRPETAEVNYRPPGRSGQPLRNSLHRGQN 162 IKG+PG P ++ LP +L N PPG+ G P N +G+N Sbjct: 128 IKGDPGPPGSQGLPGSLGTPGLRGNTGPPGKVG-PKGNQGDKGEN 171 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 35.9 bits (79), Expect = 1.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 412 ARWWYLPVRTYMRSYH 459 A WWYLP RT+ RSYH Sbjct: 569 AEWWYLPARTHKRSYH 584 >UniRef50_Q8SX83 Cluster: Protein split ends; n=10; Eukaryota|Rep: Protein split ends - Drosophila melanogaster (Fruit fly) Length = 5560 Score = 33.1 bits (72), Expect = 7.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 19 GVFIKGEPGKPSTEPLPAALRPETAEVNYRPPGRSGQPLRNSLHRGQ 159 G+ + PG + LPA L+P+ ++N PP P+ + L GQ Sbjct: 5053 GIIMPTHPGMLLQQKLPAHLQPQQHQLNPSPPPGKPNPVLHGLQSGQ 5099 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,738,105 Number of Sequences: 1657284 Number of extensions: 15448815 Number of successful extensions: 37500 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37482 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63381147830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -