BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0252 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 4.5 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 5.9 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 34 GEPGKPSTEPLPAALRPETAEVNYRPPGRSGQPLRNS 144 G PG+ T L P+ PPG SG+P R++ Sbjct: 616 GMPGEDGTPGLRGEPGPKGEPGLLGPPGPSGEPGRDA 652 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 34 GEPGKPSTEPLPAALRPETAEVNYRPPG 117 G PG ST P P A + +Y PG Sbjct: 8 GSPGAASTTPSPGAFQSLARNNSYVIPG 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,446 Number of Sequences: 2352 Number of extensions: 16349 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -