BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0250 (432 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21816| Best HMM Match : DUF1279 (HMM E-Value=1.1) 29 1.6 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 >SB_21816| Best HMM Match : DUF1279 (HMM E-Value=1.1) Length = 894 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -1 Query: 225 CPTSYPLGHDDFKTCTRLNSALELSTKALGLVINLTSVANL 103 CP+ PLG + CT S+L L+TK +G+ + + SV +L Sbjct: 527 CPS--PLGGANQLYCTPPWSSLRLTTKLVGMALPIDSVVDL 565 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 27.9 bits (59), Expect = 3.8 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = -1 Query: 327 PGVKSLLDPIDIYNVNAPPTLRYKF*GLKYSYKGCPTSYPLGHDDFKTCTR 175 P +K LLD D+ A L Y G K S K P S P G D F+ CTR Sbjct: 501 PELKDLLDSGDLAMAAAREVL-YSV-GKKDSIK-FPHSGPGGEDSFRKCTR 548 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,148,766 Number of Sequences: 59808 Number of extensions: 237190 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -