BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0250 (432 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66524-3|CAB54303.1| 475|Caenorhabditis elegans Hypothetical pr... 28 2.5 Z82274-4|CAB05228.1| 429|Caenorhabditis elegans Hypothetical pr... 27 4.4 Z82274-3|CAB05229.1| 435|Caenorhabditis elegans Hypothetical pr... 27 4.4 Z80215-6|CAD56562.2| 1052|Caenorhabditis elegans Hypothetical pr... 27 5.8 Z80215-5|CAB02273.3| 1049|Caenorhabditis elegans Hypothetical pr... 27 5.8 >Z66524-3|CAB54303.1| 475|Caenorhabditis elegans Hypothetical protein T13H5.6 protein. Length = 475 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 114 RSSNLSQDLEPSLIAPMLN 170 +S N SQD PS+ APMLN Sbjct: 348 KSRNASQDSVPSMFAPMLN 366 >Z82274-4|CAB05228.1| 429|Caenorhabditis elegans Hypothetical protein JC8.6b protein. Length = 429 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 72 NCHVCHANITEGLQRSSNLSQDLE--PSLIAPML 167 NC CH NI QRS + Q LE P+ P + Sbjct: 196 NCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKI 229 >Z82274-3|CAB05229.1| 435|Caenorhabditis elegans Hypothetical protein JC8.6a protein. Length = 435 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 72 NCHVCHANITEGLQRSSNLSQDLE--PSLIAPML 167 NC CH NI QRS + Q LE P+ P + Sbjct: 202 NCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKI 235 >Z80215-6|CAD56562.2| 1052|Caenorhabditis elegans Hypothetical protein C36B1.8b protein. Length = 1052 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 243 KYSYKGCPTSYPLGHDDFKTCTRLNSALE 157 KY ++GC TSY DD K + S +E Sbjct: 770 KYLHQGCTTSYSSFDDDNKKLSASTSTME 798 >Z80215-5|CAB02273.3| 1049|Caenorhabditis elegans Hypothetical protein C36B1.8a protein. Length = 1049 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 243 KYSYKGCPTSYPLGHDDFKTCTRLNSALE 157 KY ++GC TSY DD K + S +E Sbjct: 770 KYLHQGCTTSYSSFDDDNKKLSASTSTME 798 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,463,677 Number of Sequences: 27780 Number of extensions: 175344 Number of successful extensions: 353 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 724655464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -