BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0249 (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.50 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.50 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.1 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.4 bits (53), Expect = 0.50 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 596 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 483 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 0.50 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 596 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 483 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.1 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 594 TGLQDVYIVDDFN 632 TG+ D+++ DD N Sbjct: 114 TGISDLFVFDDLN 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,370 Number of Sequences: 438 Number of extensions: 2942 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -