BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0243 (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117342-1|AAI17343.1| 130|Homo sapiens chromosome 4 open readi... 31 3.8 BC056900-1|AAH56900.1| 1504|Homo sapiens nischarin protein. 31 3.8 BC038102-1|AAH38102.1| 1504|Homo sapiens nischarin protein. 31 3.8 AL117432-1|CAB55920.1| 993|Homo sapiens hypothetical protein pr... 31 3.8 AK172776-1|BAD18758.1| 130|Homo sapiens protein ( Homo sapiens ... 31 3.8 AK074237-1|BAB85027.1| 130|Homo sapiens protein ( Homo sapiens ... 31 3.8 AF082516-1|AAC33104.1| 1504|Homo sapiens I-1 receptor candidate ... 31 3.8 AB023192-1|BAA76819.1| 1528|Homo sapiens KIAA0975 protein protein. 31 3.8 BC112161-1|AAI12162.1| 1972|Homo sapiens tumor protein p53 bindi... 30 6.7 BC063469-1|AAH63469.1| 303|Homo sapiens RELL2 protein protein. 30 6.7 AY904026-1|AAW69392.1| 1972|Homo sapiens tumor protein p53 bindi... 30 6.7 AY038048-1|AAK71497.1| 996|Homo sapiens SEZ6 protein. 30 6.7 AF502129-1|AAM22213.1| 996|Homo sapiens HSEZ6b protein protein. 30 6.7 AF078776-1|AAC62018.1| 1972|Homo sapiens p53 tumor suppressor-bi... 30 6.7 AB210025-1|BAE06107.1| 1984|Homo sapiens TP53BP1 variant protein... 30 6.7 >BC117342-1|AAI17343.1| 130|Homo sapiens chromosome 4 open reading frame 26 protein. Length = 130 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 416 PTHLWPHLPRVHCRHPNKPALLSLDRNR 499 P H +P PR+H R PN+P + S +R Sbjct: 71 PFHFFPRRPRIHFRFPNRPFVPSRCNHR 98 >BC056900-1|AAH56900.1| 1504|Homo sapiens nischarin protein. Length = 1504 Score = 31.1 bits (67), Expect = 3.8 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 403 PVDVANP-PVATSTTGPLQT--PQQASTPIVRPEQT 501 PV+V P P A S +GP +T P +AST + PE+T Sbjct: 1055 PVEVPAPAPAAASASGPAKTPAPAEASTSALVPEET 1090 >BC038102-1|AAH38102.1| 1504|Homo sapiens nischarin protein. Length = 1504 Score = 31.1 bits (67), Expect = 3.8 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 403 PVDVANP-PVATSTTGPLQT--PQQASTPIVRPEQT 501 PV+V P P A S +GP +T P +AST + PE+T Sbjct: 1055 PVEVPAPAPAAASASGPAKTPAPAEASTSALVPEET 1090 >AL117432-1|CAB55920.1| 993|Homo sapiens hypothetical protein protein. Length = 993 Score = 31.1 bits (67), Expect = 3.8 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 403 PVDVANP-PVATSTTGPLQT--PQQASTPIVRPEQT 501 PV+V P P A S +GP +T P +AST + PE+T Sbjct: 544 PVEVPAPAPAAASASGPAKTPAPAEASTSALVPEET 579 >AK172776-1|BAD18758.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ23937 fis, clone COLF6762. ). Length = 130 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 416 PTHLWPHLPRVHCRHPNKPALLSLDRNR 499 P H +P PR+H R PN+P + S +R Sbjct: 71 PFHFFPRRPRIHFRFPNRPFVPSRCNHR 98 >AK074237-1|BAB85027.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ23657 fis, clone COLF1189. ). Length = 130 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 416 PTHLWPHLPRVHCRHPNKPALLSLDRNR 499 P H +P PR+H R PN+P + S +R Sbjct: 71 PFHFFPRRPRIHFRFPNRPFVPSRCNHR 98 >AF082516-1|AAC33104.1| 1504|Homo sapiens I-1 receptor candidate protein protein. Length = 1504 Score = 31.1 bits (67), Expect = 3.8 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 403 PVDVANP-PVATSTTGPLQT--PQQASTPIVRPEQT 501 PV+V P P A S +GP +T P +AST + PE+T Sbjct: 1055 PVEVPAPAPAAASASGPAKTPAPAEASTSALVPEET 1090 >AB023192-1|BAA76819.1| 1528|Homo sapiens KIAA0975 protein protein. Length = 1528 Score = 31.1 bits (67), Expect = 3.8 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 403 PVDVANP-PVATSTTGPLQT--PQQASTPIVRPEQT 501 PV+V P P A S +GP +T P +AST + PE+T Sbjct: 1079 PVEVPAPAPAAASASGPAKTPAPAEASTSALVPEET 1114 >BC112161-1|AAI12162.1| 1972|Homo sapiens tumor protein p53 binding protein 1 protein. Length = 1972 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 391 ENGNPVDVANPP-VATSTTGP-LQTPQQASTPIVRP 492 ++G PV++ NPP + ST P TP STP+ P Sbjct: 410 QSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP 445 >BC063469-1|AAH63469.1| 303|Homo sapiens RELL2 protein protein. Length = 303 Score = 30.3 bits (65), Expect = 6.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 422 HLWPHLPRVHCRHPNKPALLSLDRNRRAKRQKQWSKAAIKSV 547 HL P P +HC +P L+ R++ K + + + + SV Sbjct: 125 HLGPAAPCIHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSV 166 >AY904026-1|AAW69392.1| 1972|Homo sapiens tumor protein p53 binding protein, 1 protein. Length = 1972 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 391 ENGNPVDVANPP-VATSTTGP-LQTPQQASTPIVRP 492 ++G PV++ NPP + ST P TP STP+ P Sbjct: 410 QSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP 445 >AY038048-1|AAK71497.1| 996|Homo sapiens SEZ6 protein. Length = 996 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 467 CWGVCSGPVVDVATGGLATSTGFPFSLTNSVTVH 366 C G C G V+ AT G S GFP + +N++T H Sbjct: 414 CIGECPG-VIRNATTGRIVSPGFPGNYSNNLTCH 446 >AF502129-1|AAM22213.1| 996|Homo sapiens HSEZ6b protein protein. Length = 996 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 467 CWGVCSGPVVDVATGGLATSTGFPFSLTNSVTVH 366 C G C G V+ AT G S GFP + +N++T H Sbjct: 414 CIGECPG-VIRNATTGRIVSPGFPGNYSNNLTCH 446 >AF078776-1|AAC62018.1| 1972|Homo sapiens p53 tumor suppressor-binding protein 1 protein. Length = 1972 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 391 ENGNPVDVANPP-VATSTTGP-LQTPQQASTPIVRP 492 ++G PV++ NPP + ST P TP STP+ P Sbjct: 410 QSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP 445 >AB210025-1|BAE06107.1| 1984|Homo sapiens TP53BP1 variant protein protein. Length = 1984 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 391 ENGNPVDVANPP-VATSTTGP-LQTPQQASTPIVRP 492 ++G PV++ NPP + ST P TP STP+ P Sbjct: 424 QSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP 459 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,566,094 Number of Sequences: 237096 Number of extensions: 2380063 Number of successful extensions: 6898 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 6413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6898 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -