BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0236 (658 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.31 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.41 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.55 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.72 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.31 Identities = 15/71 (21%), Positives = 26/71 (36%) Frame = +1 Query: 223 KPATTSEPTTHAKPTTDSEPATNAKPTTDAEPATYAKSTTNADSATNAESATDAESATNA 402 +P T + P T + + P +P+T+ STT + T + + Sbjct: 1008 EPVTPAPPQVTTGVDTGASSTEHMHPDWTTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTT 1067 Query: 403 ESATDAESATN 435 S T + TN Sbjct: 1068 TSTTTRPTTTN 1078 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.41 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = +1 Query: 229 ATTSEPTTHAKPTTDSEPATNAKPTTD---AEPATYAKSTTNADSA-TNAESATDAESAT 396 AT S T + S P A TT + PA+ ST++ + A TN ++ ++S+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTEKAGTNNNNSKSSQSSN 196 Query: 397 NAESATDAESATNAESATNAKSTTNAE 477 + + +S NA T + Sbjct: 197 PPQIYPWMKRVHLGQSTVNANGETKRQ 223 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.0 bits (52), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 237 FRTNNTCKTNNRFRTSNKCKANNRCRTSN 323 +R N +NNR+ +N +NN R +N Sbjct: 364 WRNNQPSTSNNRWHNNNGNNSNNHWRKNN 392 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 24.6 bits (51), Expect = 0.72 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = +1 Query: 223 KPATTSEPTTHAKPTTDSEPATNAKPTTDAEPATYAKSTTNADSATNAESATDAE 387 +P T EP TT+SEP ++ T++ ++T +S ++ E Sbjct: 394 EPVPTPEP--QPTQTTESEPTQASEQPTESSTTQKPQTTKTPESGNESDGVCTKE 446 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/54 (20%), Positives = 23/54 (42%) Frame = +1 Query: 262 PTTDSEPATNAKPTTDAEPATYAKSTTNADSATNAESATDAESATNAESATDAE 423 PT + +P TT++EP ++ T + + ++ ES ++ E Sbjct: 397 PTPEPQPTQ----TTESEPTQASEQPTESSTTQKPQTTKTPESGNESDGVCTKE 446 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.306 0.114 0.304 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,300 Number of Sequences: 336 Number of extensions: 1267 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -