BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0235 (812 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_30202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 29 5.9 SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_22174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 226 YQTLLQEYMLIPPVTRAYTTACVVTTLAVQLDLVSPFQLYFNPNLIL 366 Y TL Q+ + P T +TA +T L QL F +YF IL Sbjct: 104 YLTLAQKLLYAVPATPVESTASDITPLLTQLGGFLRFHVYFTTRRIL 150 >SB_30202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -2 Query: 784 GRTPPRKSKCTDCHPTRSTEIACRAELRNQAEPRGGKVPGSSLIQRSS 641 G T + DC P R T I +R +A RGGK + + ++S Sbjct: 74 GSTKAIPTTTNDCKPGRRTRIKPAVTVRPRASDRGGKQSANKPLSKTS 121 >SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2988 Score = 28.7 bits (61), Expect = 5.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 668 WKFINPKKFILTKTFLRDHTY 606 W F NP+ + TK + +HTY Sbjct: 404 WNFANPRNIVSTKERIAEHTY 424 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +1 Query: 508 FVVMFIFGGLLMIICAFFVNLLFLGQAFTIMIVYVWSRRNVFV 636 F+ +F F ++ + AFFV ++F AF + +V+V+ VFV Sbjct: 704 FIFIFFFAFVIFVFNAFFVFVVF---AFFVFLVFVFFVSVVFV 743 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 508 FVVMFIFGGLLMIICAFFVNLLFLGQAFTIMIVYVWSRRNVFV 636 F V +F + ++ FFV+++F+ F + +VYV+ VFV Sbjct: 720 FFVFVVFAFFVFLVFVFFVSVVFV---FFVFVVYVFFALVVFV 759 >SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = +1 Query: 508 FVVMF--IFGGLLMIICAFFVNLLFLGQAFTIMIVYVWS--RRNVFVRMNF---FGLMNF 666 +V+M IF L ++ FF+ ++ G F I++ V S R + F G MN+ Sbjct: 796 YVIMLASIFVTLAKVLMLFFLFVMAFGVTFYILLENVESFDRLETSLMTTFVMTLGEMNY 855 Query: 667 QAPYLPWVLLGFSVLLGMQF 726 ++PW L ++ + + F Sbjct: 856 GDTFMPWNKLHYATFINILF 875 >SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1303 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 249 YANTTSHQGLHHSLCCHNFGCST 317 Y +TTSH HH+ C H ST Sbjct: 1142 YHHTTSHSAYHHTKCHHTTSHST 1164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,471,194 Number of Sequences: 59808 Number of extensions: 517995 Number of successful extensions: 1344 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -