BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0233 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0093 - 11063514-11064755,11065364-11065483,11066459-11066785 29 3.7 01_07_0054 - 40779336-40779599,40779734-40779848,40779998-407801... 29 4.9 >01_02_0093 - 11063514-11064755,11065364-11065483,11066459-11066785 Length = 562 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 607 LTILNHKWNTLKVDFQNLMD--ILGVRRPLPKTKTDDSTNDTFDD 479 L+ +N WN +K +FQ + + LG+ + L K DD ++D Sbjct: 354 LSEVNRVWNLIKANFQKVTNTSYLGMLQALYKLNDDDRMKQIYED 398 >01_07_0054 - 40779336-40779599,40779734-40779848,40779998-40780181, 40780322-40780393,40780485-40780611,40780830-40781011, 40781099-40781249 Length = 364 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +2 Query: 395 LTLWDVNNANKTF*NSFFFKLGSIFFRPIVKGVIS--TIVCLRFRKRSPNTQYIHKI 559 +TL ++++A + F N +G F + KG++ TIV ++ R P+ ++IH++ Sbjct: 58 MTLEELSSATRNFSNVNL--IGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEV 112 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,763,821 Number of Sequences: 37544 Number of extensions: 354350 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -