BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0233 (722 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) 28 8.8 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 28 8.8 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) Length = 452 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 514 KTDDSTNDTFDDGTEKNRS*FKKKTILKRFISIIYVP*C 398 +T++ TN+ ++ T K R +K I K S+IY+ C Sbjct: 316 RTNEQTNERTNERTNKQRDNKNEKKINKTTTSVIYLSLC 354 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 209 SLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARYQRRARAF 340 ++ D + + S VVR HP K W KFW A+ Q+ F Sbjct: 286 TITDALDRFCPSRVVRS-HPSDKPWINNKIKFWIAKRQKMLAKF 328 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 65 KNSYRL*VSPGLEALNRGVNAPPIV*PPQ*TVWN 166 +N R+ VSP L A+ R + ++ PP+ WN Sbjct: 1448 ENDIRIKVSPELSAIQRSSSRGQVLNPPESNKWN 1481 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,817,745 Number of Sequences: 59808 Number of extensions: 418962 Number of successful extensions: 713 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -