BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0233 (722 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z97053-3|CAB09783.1| 473|Homo sapiens serine incorporator 3 pro... 31 4.2 U49188-1|AAB48858.1| 494|Homo sapiens Diff33 protein. 31 4.2 BC006088-1|AAH06088.1| 473|Homo sapiens serine incorporator 3 p... 31 4.2 AK222923-1|BAD96643.1| 473|Homo sapiens tumor differentially ex... 31 4.2 AF153979-1|AAD34641.1| 494|Homo sapiens transmembrane protein S... 31 4.2 AF112227-1|AAD22448.1| 473|Homo sapiens TDE homolog protein. 31 4.2 >Z97053-3|CAB09783.1| 473|Homo sapiens serine incorporator 3 protein. Length = 473 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 >U49188-1|AAB48858.1| 494|Homo sapiens Diff33 protein. Length = 494 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 >BC006088-1|AAH06088.1| 473|Homo sapiens serine incorporator 3 protein. Length = 473 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 >AK222923-1|BAD96643.1| 473|Homo sapiens tumor differentially expressed protein 1 variant protein. Length = 473 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 >AF153979-1|AAD34641.1| 494|Homo sapiens transmembrane protein SBBI99 protein. Length = 494 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 >AF112227-1|AAD22448.1| 473|Homo sapiens TDE homolog protein. Length = 473 Score = 31.1 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 203 IVSLIDLVKIYNISWVVRKPHPKPKNWYLQSCKFWEARY 319 +V L+D +N SWV R P+ WY F A Y Sbjct: 176 LVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY 214 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,417,295 Number of Sequences: 237096 Number of extensions: 2071715 Number of successful extensions: 4363 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4363 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -