BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0232 (475 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 1.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 4.1 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 1.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 355 TPKKKVCVSAPTHDWSLLDIKK-KKKNSRGGPVPNSP 462 TP+K + S+P ++ LD+K+ N R P+P P Sbjct: 528 TPQKHLYTSSPFSEFLALDMKEAPTTNPRIVPIPTFP 564 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 4.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 269 CVMRLIAHGHTKCVIAGDAGLLRRQSATKP 180 C +RLIA G + + LLRR ++ P Sbjct: 1389 CSVRLIAEGQKRTLATSRNFLLRRGTSATP 1418 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 513,222 Number of Sequences: 2352 Number of extensions: 9726 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -