BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0230 (681 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 28 8.0 >SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4994 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -3 Query: 613 NTEYNNCLNYTRKPVSN--ANFLFHWISAYTSCKMDAITDNCRGLSRI 476 N EY NC T+K ++ F + Y CK DA C+ + +I Sbjct: 496 NAEYQNCFQRTKKRIARDPGQKSFGFSEMYIFCKFDAF---CKRIEKI 540 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 146 TRGLSSPITFFPINSEYVRKVV 211 T+GLS + F PI ++YV +V+ Sbjct: 817 TKGLSDKVYFLPITADYVTQVI 838 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,392,574 Number of Sequences: 59808 Number of extensions: 318838 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -