BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0230 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92832-1|CAB07370.1| 450|Caenorhabditis elegans Hypothetical pr... 28 5.4 U23514-1|AAC46543.1| 817|Caenorhabditis elegans Hypothetical pr... 27 9.4 >Z92832-1|CAB07370.1| 450|Caenorhabditis elegans Hypothetical protein F31D4.2 protein. Length = 450 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -2 Query: 545 LDFCLHFLQNGRHYGQLSRFI*DLLYKTVVSGELNFQ 435 LD+ + L+NG + G+ SR + + L K + SG++ +Q Sbjct: 302 LDWTIEQLKNGENIGEESRALGEKLEKRMKSGQIVYQ 338 >U23514-1|AAC46543.1| 817|Caenorhabditis elegans Hypothetical protein F48E8.6 protein. Length = 817 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 581 QETCFKCQFSIPLDFCLHFLQNGRHY 504 Q+ + C F +PL F HF N HY Sbjct: 606 QQAKYFCTFEMPLSFYHHFALNVDHY 631 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,376,026 Number of Sequences: 27780 Number of extensions: 254735 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -