BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0228 (788 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc... 27 3.1 SPAC12B10.08c |||mitochondrial tRNA|Schizosaccharomyces pombe|ch... 26 7.1 SPCC188.04c |spc25||kinetochore protein Spc25|Schizosaccharomyce... 25 9.4 >SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1310 Score = 27.1 bits (57), Expect = 3.1 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -3 Query: 768 LLSLTD*SLNTGIKSSQPSVN-VYDQHLSVIRTLHITTVPTLQVERQ-NHIYK 616 L L D ++ T PS++ V+D + TLH T + L ++RQ H YK Sbjct: 421 LHKLIDSAMQTEKVKKDPSLSQVFDGISNSFNTLHKTVLEMLDLQRQAEHYYK 473 >SPAC12B10.08c |||mitochondrial tRNA|Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 25.8 bits (54), Expect = 7.1 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = -3 Query: 426 AFTLWMSMGSSNHLTPGGL*ARPPIKAINKKKSIGGSH*LILDRQ*ATHYKKPINKSSK 250 A T++M + T GGL A P+ I + SI G+ + L R +YK I ++K Sbjct: 138 AETIFMRLLRRKPGTWGGLCAMKPVSQIPESDSICGASNIELLRPLLPYYKNQILNTAK 196 >SPCC188.04c |spc25||kinetochore protein Spc25|Schizosaccharomyces pombe|chr 3|||Manual Length = 238 Score = 25.4 bits (53), Expect = 9.4 Identities = 11/50 (22%), Positives = 22/50 (44%) Frame = -3 Query: 744 LNTGIKSSQPSVNVYDQHLSVIRTLHITTVPTLQVERQNHIYKETEIKFW 595 L+ +K Q D + ++I + ++ +R+ Y E+KFW Sbjct: 98 LDAMLKRKQKLSEELDHYRAIISSKRELRAQEMEAKRKQDSYNNPELKFW 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,281,850 Number of Sequences: 5004 Number of extensions: 67822 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -