BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0228 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.7 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 25 3.5 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 24 6.2 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 492 QTETHYCFTPEIGGAVVPTRADSQEVLPPVKTPDTRT 602 + ++ Y P+ G P A +Q LPPV+ P+T T Sbjct: 1445 EAKSSYQQQPDSGTEQAPREATAQ--LPPVQPPETLT 1479 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 24.6 bits (51), Expect = 3.5 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 462 MYSYNGCPNLQTETHYCFTPEIGGAVVPTRADSQEVLPPVKTPDTRTLFP 611 +YS P L + HYC + I VV R S+E ++TP R+ FP Sbjct: 57 VYSSYVLPKLYAKLHYCVSCAIHSKVVRNR--SKET-RRIRTPPQRS-FP 102 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.8 bits (49), Expect = 6.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 656 SPPYKWKGKITFIKKRK 606 S P +W G +T KKRK Sbjct: 259 SNPLEWTGNVTVRKKRK 275 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 838,357 Number of Sequences: 2352 Number of extensions: 17679 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -