BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0226 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.6 Z69982-1|CAA93822.1| 143|Anopheles gambiae lectin protein. 24 4.5 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 24 4.5 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 7.8 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 23 7.8 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 477 SCRRGAGILFPTTACHGPHSLRGRDSWTPEGSH 379 SC R AG F T+ S R S + GSH Sbjct: 1330 SCERIAGETFECTSTSSKFSTSSRGSGSDSGSH 1362 >Z69982-1|CAA93822.1| 143|Anopheles gambiae lectin protein. Length = 143 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 747 RRATLVGNVRRPHDPPDLSIAAGPATDRRDNRRFSRQLSPQ 625 R+ T+ G R HD ++++ GP T+ RD+ + P+ Sbjct: 25 RKITIRG--RMTHDQFNINLQTGPNTNPRDDTALHISIRPR 63 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.2 bits (50), Expect = 4.5 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 478 LNIPRISFFYAETTSVP----ASIGFMGFTMSAKGGITLNYGRRSQTASTVFPL 627 + I R + +Y VP +S+ +GFT+ G L G + TVF L Sbjct: 225 IQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGLTILVSQTVFSL 278 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 7.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 408 RDSWTPEGSHHTQTT 364 ++ W PE +HH Q T Sbjct: 37 KEKWVPEITHHCQKT 51 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 23.4 bits (48), Expect = 7.8 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = +3 Query: 663 GGLSPDL-----QLWTDPADHEADGRSRPGLLCD 749 G L+P+L +LWTDP + RSR L D Sbjct: 116 GELTPELVSLMKKLWTDPGVQQCFARSREYQLND 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 844,237 Number of Sequences: 2352 Number of extensions: 18906 Number of successful extensions: 47 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -