BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0222 (720 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR788268-5|CAI95050.1| 1288|Homo sapiens contactin associated pr... 31 5.5 CR788268-2|CAI95046.1| 1175|Homo sapiens contactin associated pr... 31 5.5 BX664735-4|CAI16326.1| 1288|Homo sapiens contactin associated pr... 31 5.5 BX664735-1|CAI16324.1| 1175|Homo sapiens contactin associated pr... 31 5.5 BX649569-4|CAI12628.1| 1288|Homo sapiens contactin associated pr... 31 5.5 BX649569-1|CAI12626.1| 1175|Homo sapiens contactin associated pr... 31 5.5 BC132737-1|AAI32738.1| 1207|Homo sapiens CNTNAP3 protein protein. 30 9.6 BC022557-1|AAH22557.1| 412|Homo sapiens TMEM22 protein protein. 30 9.6 BC000111-1|AAH00111.1| 390|Homo sapiens TMEM22 protein protein. 30 9.6 AL353729-6|CAH72042.1| 1039|Homo sapiens contactin associated pr... 30 9.6 AL353729-3|CAH72039.1| 1288|Homo sapiens contactin associated pr... 30 9.6 AL162501-4|CAH70490.1| 1039|Homo sapiens contactin associated pr... 30 9.6 AL162501-2|CAH70488.1| 1288|Homo sapiens contactin associated pr... 30 9.6 AF333769-1|AAG52889.2| 1288|Homo sapiens cell recognition molecu... 30 9.6 AB051501-1|BAB21805.2| 1175|Homo sapiens KIAA1714 protein protein. 30 9.6 >CR788268-5|CAI95050.1| 1288|Homo sapiens contactin associated protein-like 3B protein. Length = 1288 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 732 DSQYYCNCDAGQNEWTSDTIVLS 754 >CR788268-2|CAI95046.1| 1175|Homo sapiens contactin associated protein-like 3B protein. Length = 1175 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 780 DSQYYCNCDAGQNEWTSDTIVLS 802 >BX664735-4|CAI16326.1| 1288|Homo sapiens contactin associated protein-like 3B protein. Length = 1288 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 732 DSQYYCNCDAGQNEWTSDTIVLS 754 >BX664735-1|CAI16324.1| 1175|Homo sapiens contactin associated protein-like 3B protein. Length = 1175 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 780 DSQYYCNCDAGQNEWTSDTIVLS 802 >BX649569-4|CAI12628.1| 1288|Homo sapiens contactin associated protein-like 3B protein. Length = 1288 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 732 DSQYYCNCDAGQNEWTSDTIVLS 754 >BX649569-1|CAI12626.1| 1175|Homo sapiens contactin associated protein-like 3B protein. Length = 1175 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA + W S+T + S Sbjct: 780 DSQYYCNCDAGQNEWTSDTIVLS 802 >BC132737-1|AAI32738.1| 1207|Homo sapiens CNTNAP3 protein protein. Length = 1207 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 731 DSQYYCNCDAGRNEWTSDTIVLS 753 >BC022557-1|AAH22557.1| 412|Homo sapiens TMEM22 protein protein. Length = 412 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 46 EFINQRSVY--LRVKIVCLKHQTYFNHYQFRLSLFKYIYCNSIKI 174 E I RSV+ L V +VC + F +RL LF Y CN I I Sbjct: 135 ELIFIRSVFQVLSVLVVCYYEEAPFGPSGYRLRLFFYGVCNVISI 179 >BC000111-1|AAH00111.1| 390|Homo sapiens TMEM22 protein protein. Length = 390 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 46 EFINQRSVY--LRVKIVCLKHQTYFNHYQFRLSLFKYIYCNSIKI 174 E I RSV+ L V +VC + F +RL LF Y CN I I Sbjct: 113 ELIFIRSVFQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISI 157 >AL353729-6|CAH72042.1| 1039|Homo sapiens contactin associated protein-like 3 protein. Length = 1039 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 644 DSQYYCNCDAGRNEWTSDTIVLS 666 >AL353729-3|CAH72039.1| 1288|Homo sapiens contactin associated protein-like 3 protein. Length = 1288 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 732 DSQYYCNCDAGRNEWTSDTIVLS 754 >AL162501-4|CAH70490.1| 1039|Homo sapiens contactin associated protein-like 3 protein. Length = 1039 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 644 DSQYYCNCDAGRNEWTSDTIVLS 666 >AL162501-2|CAH70488.1| 1288|Homo sapiens contactin associated protein-like 3 protein. Length = 1288 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 732 DSQYYCNCDAGRNEWTSDTIVLS 754 >AF333769-1|AAG52889.2| 1288|Homo sapiens cell recognition molecule CASPR3 protein. Length = 1288 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 732 DSQYYCNCDAGRNEWTSDTIVLS 754 >AB051501-1|BAB21805.2| 1175|Homo sapiens KIAA1714 protein protein. Length = 1175 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 335 ENEYYCECDAYEGLWKSNTCLTS 267 +++YYC CDA W S+T + S Sbjct: 780 DSQYYCNCDAGRNEWTSDTIVLS 802 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,006,323 Number of Sequences: 237096 Number of extensions: 1843608 Number of successful extensions: 2864 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2864 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -