BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0220 (388 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces p... 44 8e-06 SPBC725.17c |rrn11||RNA polymerase I transcription factor subuni... 30 0.11 SPBC685.07c |rpl2701|rpl27-1|60S ribosomal protein L27|Schizosac... 27 0.78 SPCC74.05 |rpl2702|rpl27-2|60S ribosomal protein L27|Schizosacch... 27 1.0 SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p... 25 3.1 SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosacch... 25 5.5 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 24 9.6 >SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces pombe|chr 3|||Manual Length = 195 Score = 44.0 bits (99), Expect = 8e-06 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 5/77 (6%) Frame = +3 Query: 171 QIGGEKNGGTRTV-PL-KRRKSFYPT-QEKI--RASSGGRPFSKHVRRIRPNLKIGTVCI 335 ++ G KNGG R V P + +YP +E + +A RP ++R +L GTVCI Sbjct: 5 KVNGAKNGGERMVLPAGEAAAKYYPAYRENVPKKARKAVRP-----TKLRASLAPGTVCI 59 Query: 336 LLAGRHAGKKVVLVGIL 386 LLAGR GK+VV++ L Sbjct: 60 LLAGRFRGKRVVVLSQL 76 >SPBC725.17c |rrn11||RNA polymerase I transcription factor subunit Rrn11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 200 Score = 30.3 bits (65), Expect = 0.11 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 379 PTSTTFLPACLPARRMQTVPIFRLGRILRTCLLNGRPPDEARIFS 245 P S+ P LP+RR +T I L ++ CLL P +R FS Sbjct: 21 PESSVIPPIPLPSRRYKTRHIDALCSLMHLCLLRKDYPRASRAFS 65 >SPBC685.07c |rpl2701|rpl27-1|60S ribosomal protein L27|Schizosaccharomyces pombe|chr 2|||Manual Length = 136 Score = 27.5 bits (58), Expect = 0.78 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 312 LKIGTVCILLAGRHAGKKVVLV 377 LK G V ++ GR AGKKVV++ Sbjct: 5 LKPGKVALITRGRFAGKKVVIL 26 >SPCC74.05 |rpl2702|rpl27-2|60S ribosomal protein L27|Schizosaccharomyces pombe|chr 3|||Manual Length = 136 Score = 27.1 bits (57), Expect = 1.0 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 312 LKIGTVCILLAGRHAGKKVVLV 377 LK G V ++ GR AGKKVV++ Sbjct: 5 LKPGKVALVTRGRFAGKKVVIL 26 >SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.4 bits (53), Expect = 3.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 20 STKKPRNYDLGNGVMRFSKSKMF 88 +TK PRN+ L N ++RFS +F Sbjct: 289 NTKGPRNFVLENHLVRFSSLYIF 311 >SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosaccharomyces pombe|chr 2|||Manual Length = 652 Score = 24.6 bits (51), Expect = 5.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 76 IQDVPQXRLNTSSLAK 123 +QDVPQ RL++S L K Sbjct: 245 LQDVPQRRLDSSELLK 260 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 23.8 bits (49), Expect = 9.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 223 LRLRGTVLVPPFFSPPICFT 164 + L TV P FF+P +C+T Sbjct: 302 VELAKTVGTPAFFAPELCWT 321 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,571,331 Number of Sequences: 5004 Number of extensions: 27977 Number of successful extensions: 71 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 128344734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -