BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0220 (388 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal prote... 33 0.053 Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical pr... 30 0.65 >U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal protein, large subunitprotein 6 protein. Length = 217 Score = 33.5 bits (73), Expect = 0.053 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 300 IRPNLKIGTVCILLAGRHAGKKVVLV 377 +R L GTV I+LAGRH GK+VV + Sbjct: 67 LRKTLTPGTVLIVLAGRHKGKRVVFL 92 Score = 28.3 bits (60), Expect = 2.0 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 35 RNYDLGNGVMRFSKSKMFHKXG 100 RN+DL GV+RFS S++ K G Sbjct: 12 RNFDLSPGVLRFSASRLRLKKG 33 >Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical protein C54C8.12 protein. Length = 82 Score = 29.9 bits (64), Expect = 0.65 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 231 FYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKK 365 FYPT+ +A S G P + PN ++ V A RHAG + Sbjct: 26 FYPTEISTKARSHGHPVNTLGESEDPNFQVDNVPGERARRHAGPR 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,795,046 Number of Sequences: 27780 Number of extensions: 167616 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -